PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000768445
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family GRAS
Protein Properties Length: 630aa    MW: 71400.9 Da    PI: 6.1223
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000768445genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS275.71.5e-842646272374
           GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlar.svselykalppsetseknsseelaalklfsevsPilkfshl 96 
                     + Ll++Ae v  +++e+a++lL r +  as + +p+qR+++yf+eAL++r+ + +++++yk  + s+ s    s++l++  + ++  P++ + ++
  MDP0000768445 264 AHILLAAAEKVGYQQFERANRLLLRCEFAASFKVNPVQRVVFYFAEALRERIEKeTGNSMYKGNEISSYSL-GLSTNLTFI-ACHQDIPFHPVLQF 357
                    699***************************************************77888888777777763.244444443.466778******** PP

           GRAS  97 taNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegpp.slRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledlel 191
                    +a q Ile v+ e++vH iD++i  G+QW  L++ La+R+e p   l iT+vg    + k+++eetg+rLa++A++l+vpf+f++++++++ed++ 
  MDP0000768445 358 AAIQVILENVALESKVHLIDLEIRSGVQWTGLMEVLAEREECPIeLLTITAVGV---TGKQKIEETGRRLASVAKALNVPFQFKAVIVTDMEDVKN 450
                    ****************************************7665499*******...68************************************* PP

           GRAS 192 eeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvEr 287
                    + ++v+  Ea++V   l l ++  ++ +le+    +++++++l P v+vv e ea+hns+sF++rf++al yysa+fd+lea + +++e r+++Er
  MDP0000768445 451 QLFDVEDXEAVVVYAPLILRTMILRPRCLEN----LMRVMRNLTPCVMVVNEVEANHNSPSFVNRFIDALFYYSAFFDCLEACM-KQEESRVMMER 541
                    ***********************99999999....***********************************************96.66677888887 PP

           GRAS 288 ellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                      l++ i+n+va+eg+er+ r+ ++e Wr+ + ++ + ++++s+   +qa+l+ +k++s   +++   ++l+ gWk+ p+ s+SaW+
  MDP0000768445 542 L-LHEGIRNIVAAEGSERVTRNVKMEVWRAFFARFRMVEINFSKASLNQASLVAKKFGSPSCTLHRIGKCLIVGWKGTPIHSLSAWK 627
                    7.**********************************************************9*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098539.487237607IPR005202Transcription factor GRAS
PfamPF035145.1E-82264627IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 630 aa     Download sequence    Send to blast
MANAFFSFTP FDFGVVGGGG GLTPQLEDYE KEDQKVVVFK GKPEHLFGME ELGLGEMEKF  60
PHLSKDQPQS KTSYSMLDNF SFDTVCSEHD LQRSNMSEKE LDHVSKDHDH RHYQQQNQHY  120
QQQSKSNYSD LDNFNFDSAF HSTQPIQDVA NQLTFGGSDI AETNKQMPHQ SSLAVLELLN  180
NYGSAFKKLK RDRFSNSCNE AGASSMSSYS IQQKLSTEEI MRVAGARYVQ FSNQGYDDFF  240
VPSHPFGYAL SGLSEEETKD VELAHILLAA AEKVGYQQFE RANRLLLRCE FAASFKVNPV  300
QRVVFYFAEA LRERIEKETG NSMYKGNEIS SYSLGLSTNL TFIACHQDIP FHPVLQFAAI  360
QVILENVALE SKVHLIDLEI RSGVQWTGLM EVLAEREECP IELLTITAVG VTGKQKIEET  420
GRRLASVAKA LNVPFQFKAV IVTDMEDVKN QLFDVEDXEA VVVYAPLILR TMILRPRCLE  480
NLMRVMRNLT PCVMVVNEVE ANHNSPSFVN RFIDALFYYS AFFDCLEACM KQEESRVMME  540
RLLHEGIRNI VAAEGSERVT RNVKMEVWRA FFARFRMVEI NFSKASLNQA SLVAKKFGSP  600
SCTLHRIGKC LIVGWKGTPI HSLSAWKFR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-2929262732375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008386716.10.0PREDICTED: DELLA protein RGL1-like
TrEMBLM5VUD50.0M5VUD5_PRUPE; Uncharacterized protein
STRINGVIT_07s0005g01500.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF47933162
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66350.12e-51RGA-like 1